PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004865.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 291aa    MW: 32446.3 Da    PI: 4.3228
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004865.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK59.18.4e-19103153252
                   RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              + ++++e+ s+yF+lp ++AA eL+v+  v K++CR+ GI+ WP+Rk+ sl
  Itr_sc004865.1_g00001.1 103 TTTLTFEKFSEYFYLPSEQAAEELQVGREVFKKKCREVGISYWPYRKLVSL 153
                              5789*******************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.90386174IPR003035RWP-RK domain
PfamPF020429.0E-16105153IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MADTTYPSSS DNSSFWDDII ISPLRDSAQS IDLTTVENFE NAPPESNEII TPLGATGTDV  60
VAVDQGTAVV AEEDNTTAVL DVAAMNASVF RGRKRARRTF CDTTTLTFEK FSEYFYLPSE  120
QAAEELQVGR EVFKKKCREV GISYWPYRKL VSLDRLLAKV QEFGEIKDQA ELQRTIKGLE  180
DERDTILQNP NLDLADATVR LRDKCDRNSS RRRRYIDPAT FSSTTPGSSS QALKFPDLPE  240
LAPEAFLSTT LGSLSQAPIF PDIPKLAPEE IQEVLAWLDE DVPPPKNISD K
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-26RWP-RK domain-containing protein